PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG007195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TCP
Protein Properties Length: 312aa    MW: 33062.1 Da    PI: 7.7281
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG007195.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.62.2e-3480149473
          TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                  +k+  +++hTkv+gR+RRvR++a+caar+F+L++eLG+++ ++ti WLl+ a++ai+++tgt++ +a ++
  CCG007195.1  80 AKRNRKDRHTKVEGRGRRVRMPATCAARIFQLTRELGHKSEGETISWLLEHAEAAIIAATGTGTVPAIAV 149
                  78999*********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-2883158IPR005333Transcription factor, TCP
PROSITE profilePS5136926.45284138IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDSPPHHHHR TLEKIDKEQS ITTASLSSQP ELKDDNLTDP EESQEFEEHD NNERINNGSS  60
SSSLVLHQVQ RKQQQVVIAA KRNRKDRHTK VEGRGRRVRM PATCAARIFQ LTRELGHKSE  120
GETISWLLEH AEAAIIAATG TGTVPAIAVS VNGTLKIPTE TPPRTTAEAD IDAVGLVPNK  180
KRKRPCNSDF VDLTEAAHQN SVSSGLAPIA STSPQGLVPI WPMGTLLFPQ GSSVSVGVGE  240
SNQAPFWAFP AASTTPCFNM AAKPISSLVS AMQPGVQLAG NVGVGFGGGG SLGSGGSPSN  300
NIGSMSSSLR IK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318838.21e-167hypothetical protein POPTR_0012s13700g
SwissprotQ9LT894e-65TCP19_ARATH; Transcription factor TCP19
TrEMBLB9I4D71e-167B9I4D7_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13700.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-46TCP family protein